<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14445

Description Uncharacterized protein
SequenceMWQAKGGNGTKKGAGGGGAAGNGLVAVAIDNQKGSQNALRWAAENVITRGQTVVLLHVVQKSSSTSSLAGNNALICDVSNPSQSPRKQQLEKMTKDLFLTFHCYCTRKDINCLDIVLEDTDIAKAVTEYVSYAAIENLVLGAPAKHGFIRFKTSSIPSSVSKGAPDFCTVYVISKGKISSVRNASRAAPYSSPLVNQIDSLNKQSFKPPETPRYNNMYLKARPSFKPRNLQDEAYRLGLTRGGFSNGRISGGFSESESDISFISSERASTDRASSVTYDFMDTNRGRISTSSDQSFGSMHQGPKFADLSSLHDFSSVSHESNLTSSSWSSQNLEEVESEMRRLKLELKQTMDMYSTACREALSAKQKEMELHNWRVVEEQKLEEARLGQEAAIAVAEKERVRCRAAMEAADAAKRIAQLESQKRANTEIKALREAEDMRKLLDNLAQTDDKYRRYAIEEIEQATEHFAPSRKIGEGGYGPVFKCYLDHTPVAVKVLRPDAAQGRTQFQKEIDILSCIRHPNMVLLLGACPEYGVLVYEYMANGSLEDCLIKRGNNPALSWQLRFRIAAEIGTGLLFLHQTKPEPLVHRDLKPGNILLDHNYVSKISDVGLARLVPAVAENMTQCLMTATAGTFCYIDPEYQQTGMLGVKSDVYSLGIILLQLLTGRSPMGLAHHVDKAIEKDTFEEMLDPAVPDWPVEEALSLAKLAIQCAELRRKDRPDLGTVVLPSLNKWRELAEDKMNHKLIDGNNGLSPHHSHVPDQQEVMSDPRLNNSGTSKSQSSTSSQIENQAEAGPTETE
Length798
PositionTail
OrganismPrunus persica (Peach) (Amygdalus persica)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
Aromaticity0.06
Grand average of hydropathy-0.449
Instability index46.67
Isoelectric point6.48
Molecular weight88055.55
Publications
PubMed=23525075

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14445
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.70|      16|      16|     193|     208|       1
---------------------------------------------------------------------------
  193-  208 (27.69/18.31)	PLVNQIDSL...NKQSFKP
  209-  227 (24.01/14.88)	PETPRYNNMylkARPSFKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.18|      34|     378|     101|     176|       2
---------------------------------------------------------------------------
  120-  167 (39.56/95.86)	TDIAKAVTeyvsYAAIEnlvlgapAKHGfiRFKTSSIPS..SVSKGaPDF
  270-  305 (59.62/21.84)	TDRASSVT....YDFMD.......TNRG..RISTSSDQSfgSMHQG.PKF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.47|      16|      16|     377|     392|       4
---------------------------------------------------------------------------
  377-  392 (25.08/17.22)	VEEQKLEEARLGQEAA
  395-  410 (26.39/18.52)	VAEKERVRCRAAMEAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.75|      16|      16|     338|     353|       5
---------------------------------------------------------------------------
  338-  353 (27.46/22.00)	SEMRRLKLELKQ.TMDM
  355-  371 (22.29/16.29)	STACREALSAKQkEMEL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14445 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EDKMNHKLIDGNNGLSPHHSHVPDQQEVMSDPRLNNSGTSKSQSSTSSQIENQAEAGPTETE
737
798










Molecular Recognition Features






MoRF SequenceStartStop




NANANA