Description | Uncharacterized protein |
Sequence | MDLEAKRFGRGPRELGGATDLINLYKLWPHHEFFCKRSLPLSISETHYLHNVVGDTLIRKGEGMELDQLFQGNLYMREKNAHIHPFDLDVLCEAFLIRETTPVKLPSAEKGIRTSVVKSKSELENKERKHKKHKDKDKDHKKHKNRHKDNSGDAVKNINVDYGLKTEQLKERQDMFIQKRRLDGFEDPSVFGHKKARIQR |
Length | 200 |
Position | Head |
Organism | Prunus persica (Peach) (Amygdalus persica) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.991 |
Instability index | 45.10 |
Isoelectric point | 9.52 |
Molecular weight | 23405.51 |
Publications | PubMed=23525075 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP14437 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KERKHKKHKDKDKDHKKHKNR 2) MFIQKRRL | 126 175 | 146 182 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab