<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14436
| Description |
Uncharacterized protein |
| Sequence | MDRKFSNKKCPRELGGATDLINLYKLWPHHEFFCKRSLPLSISETHYLHNVVGDTLIRKGEGMELDQLFQSNLYMREKNAHIHPFDLDVLCEAFLIRETTPVKLPSVRHFLHLCLLSLIEHKNPMSTVVDKTEAKAKGKATTTIMIMTTSTESEASKGNVNCGSSGHDNNSSRKRQ |
| Length | 176 |
| Position | Head |
| Organism | Prunus persica (Peach) (Amygdalus persica) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.486 |
| Instability index | 46.22 |
| Isoelectric point | 8.80 |
| Molecular weight | 19994.77 |
| Publications | PubMed=23525075
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14436
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.80| 12| 20| 90| 101| 1
---------------------------------------------------------------------------
90- 101 (21.90/13.38) LCEAFLIRETTP
113- 124 (21.90/13.38) LCLLSLIEHKNP
---------------------------------------------------------------------------
|