<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14435
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQVNTIASLAFNTFGTLQRDSPPVRLSPNYPEPPANPTEDAENFAEHAKLFDALVAALPLAEGGEEAQLKRIAELQAENDAVGQELQRQLEAAEKELKEVRELFSQAADNCLNLKKPD |
| Length | 126 |
| Position | Middle |
| Organism | Prunus persica (Peach) (Amygdalus persica) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.525 |
| Instability index | 51.47 |
| Isoelectric point | 4.41 |
| Molecular weight | 13884.30 |
| Publications | PubMed=23525075
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14435
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.32| 15| 27| 74| 88| 2
---------------------------------------------------------------------------
74- 88 (24.65/15.47) EAQLKRIAEL..QAEND
102- 118 (19.67/11.10) EKELKEVRELfsQAADN
---------------------------------------------------------------------------
|