<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14372
| Description |
Uncharacterized protein |
| Sequence | MDPEGTKFGQGPKELTGAVDLISHYKLLPHHEFFCKRSLPVSISDTHYLHNVVGDTEIRKGDGMQLDQLIQSTSYFSKPRIQPFDLDILREAFHLRETAPIDLPLADKGIPTIAAKSKSESKDKEKKHKKHKDRDKEKDKEHKKHKRRHKDRSKDKDKEKKKEKSGHHESTGDHSKKHHEKKRKHDGDEDLNDVHRHKKT |
| Length | 200 |
| Position | Head |
| Organism | Prunus persica (Peach) (Amygdalus persica) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.501 |
| Instability index | 44.34 |
| Isoelectric point | 9.48 |
| Molecular weight | 23315.03 |
| Publications | PubMed=23525075
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14372
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.71| 11| 15| 118| 128| 1
---------------------------------------------------------------------------
118- 128 (21.84/ 7.70) KSESKDKEKKH
152- 162 (19.87/ 6.44) RSKDKDKEKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.94| 19| 33| 131| 149| 2
---------------------------------------------------------------------------
131- 149 (33.95/11.53) HKDRDKEKDKEHKKHKRRH
167- 185 (32.98/11.01) HHESTGDHSKKHHEKKRKH
---------------------------------------------------------------------------
|