<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14365

Description Uncharacterized protein
SequenceMAPPRGRGGSGGGFRGRGDGGRGGRGGGRFGGGGRGGDRGGSAFKSRGGGRGGDRGGRGGRGRGGGRGGMKGGNKVVVEPHRHEGVFIAKGKEDALVTKNMVPGEAVYNEKRISVQNEDGTKVEYRIWNPFRSKLAAAILGGVDDIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARIVALNASYFLKAGGHFVISIKANCIDSTSPAEAVFQQEVKRLQADQFKPMEQVTLEPFERDHACVVGGYRVPKKSKTAA
Length314
PositionUnknown
OrganismPrunus persica (Peach) (Amygdalus persica)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Rosales> Rosaceae> Amygdaloideae> Amygdaleae> Prunus.
Aromaticity0.07
Grand average of hydropathy-0.430
Instability index28.27
Isoelectric point10.21
Molecular weight33182.31
Publications
PubMed=23525075

Function

Annotated function 
GO - Cellular Component
box C/D RNP complex	GO:0031428	IBA:GO_Central
Cajal body	GO:0015030	IBA:GO_Central
small-subunit processome	GO:0032040	IBA:GO_Central

GO - Biological Function
histone-glutamine methyltransferase activity	GO:1990259	IBA:GO_Central
RNA binding	GO:0003723	IBA:GO_Central
rRNA methyltransferase activity	GO:0008649	IBA:GO_Central

GO - Biological Process
box C/D RNA 3'-end processing	GO:0000494	IBA:GO_Central
histone glutamine methylation	GO:1990258	IBA:GO_Central
rRNA methylation	GO:0031167	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14365
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.03|      18|      27|      12|      37|       1
---------------------------------------------------------------------------
    6-   29 (33.41/ 8.38)	GRGGsgGG..FRGRGdggrGGRGGGR
   34-   55 (31.62/ 7.84)	GRGGdrGGsaFKSRG....GGRGGDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.37|      16|      17|     261|     276|       2
---------------------------------------------------------------------------
  261-  276 (26.45/19.86)	DSTSPAEAVFQQEVKR
  280-  295 (28.93/22.33)	DQFKPMEQVTLEPFER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.45|      12|      17|     204|     215|       3
---------------------------------------------------------------------------
  204-  215 (21.54/16.70)	IIEDARHPAKYR
  224-  235 (20.91/16.02)	IFSDVAQPDQAR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14365 with Med36 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAPPRGRGGSGGGFRGRGDGGRGGRGGGRFGGGGRGGDRGGSAFKSRGGGRGGDRGGRGGRGRGGGRGGMKGGNKVVVEPHRHE
1
84










Molecular Recognition Features






MoRF SequenceStartStop




1) MAPPRGRGGSGGGFRGRGDGGRGGRGGGRFGGGGRGGDRGGSAFKSRGGGRGGDRGGRGGRGR
1
63