<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14355
| Description |
Uncharacterized protein |
| Sequence | MDPESKKFERGPRELTGAVDLISHYKLLPHHEFFCKRSLPLSISDTHYLHTVVGDTEIRKGEGMQLDQLIQNTSYSRDSNSRIQPFDLDVLREAFQFKETTPVDLPPAEKGTPTIAAKSKSESKDKERKHKKHKDKDKEKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGGDHSKKHHEKKRKHDGDEYINDVHKHKKT |
| Length | 204 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.650 |
| Instability index | 38.74 |
| Isoelectric point | 9.45 |
| Molecular weight | 23914.49 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14355
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.89| 17| 19| 140| 158| 2
---------------------------------------------------------------------------
155- 172 (26.61/ 9.87) DRSKdKDKEKKKDRSGHH
186- 202 (28.28/ 6.28) KRKH.DGDEYINDVHKHK
---------------------------------------------------------------------------
|