<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14354

Description Uncharacterized protein
SequenceMANYNRDFNPFLFPSTSIAYSPVSYSSSSLSSSPPPSQSISSTFQSSSSLPLLPPQYSSSSVHPPAGATATAVPISCTASAVDGAFGATNIVKSPLDSSPGGEPAMDLRDWRVHLQPDSRRRIVSKIAETLMRHLPFSGEGGLQEIKKIAVRFEEKVYDSATSESDYLRKISLKMLTMENRTQDNVPSSAPSYSSVCSNEVQVQEDDGEPAVNMCDWRAHLQLDSRQRIVNKIAETLKRHLLLSDEEALQEIKKIAARFEEKIYVDATSQSDYLRKISLKMLTMESKASK
Length290
PositionTail
OrganismManihot esculenta (Cassava) (Jatropha manihot)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae> Manihot.
Aromaticity0.07
Grand average of hydropathy-0.438
Instability index75.72
Isoelectric point6.24
Molecular weight31944.59
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14354
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.31|      15|      19|     114|     128|       1
---------------------------------------------------------------------------
  114-  128 (29.47/22.22)	HLQPDSRR...RIVSKIA
  134-  150 (19.67/12.50)	HL.PFSGEgglQEIKKIA
  220-  234 (28.17/20.93)	HLQLDSRQ...RIVNKIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     117.94|      30|     104|     152|     181|       2
---------------------------------------------------------------------------
  152-  181 (59.13/46.60)	RFEEKVYDSATSESDYLRKISLKMLTMENR
  258-  287 (58.81/46.31)	RFEEKIYVDATSQSDYLRKISLKMLTMESK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.73|      17|      18|      26|      42|       3
---------------------------------------------------------------------------
   15-   36 (27.75/10.46)	STSIayspvSY...SSSSLSSSPPP
   37-   56 (26.99/10.01)	SQSI.....SStfqSSSSLPLLPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.36|      10|      18|      60|      69|       4
---------------------------------------------------------------------------
   60-   69 (19.47/11.24)	SSVHPPAGAT
   80-   89 (17.89/ 9.86)	SAVDGAFGAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.81|      11|     104|     102|     112|       5
---------------------------------------------------------------------------
  102-  112 (24.30/16.71)	GEPAMDLRDWR
  208-  218 (25.51/17.85)	GEPAVNMCDWR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14354 with Med15 domain of Kingdom Viridiplantae
Unable to open file!