<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14353
| Description |
Uncharacterized protein |
| Sequence | MDPESKKFERGPRELTGAVDLISHYKLLPHHEFFCKRSLPLSISDTHYLHTVVGDTEIRKGEGMQLDQLIQNTSYSRDSNSRIQPFDLDVLREAFQFKETTPVDLPPAEKGTPTIAAKSKSESKDKERKHKKHKDKDKEKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGGDHSKKHHEKKRKHDGDEYINDVHKHKKSKHKSSKIDEIGVIKVAG |
| Length | 221 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.543 |
| Instability index | 38.19 |
| Isoelectric point | 9.51 |
| Molecular weight | 25691.57 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14353
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.87| 15| 15| 124| 138| 1
---------------------------------------------------------------------------
124- 138 (29.28/ 7.74) KDKERKHKKHKDKDK
140- 154 (29.59/ 7.89) KDKEHKKHKHRHKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.64| 19| 20| 155| 173| 2
---------------------------------------------------------------------------
155- 173 (34.91/12.75) DRSKDKDKEKK.KDRSGHHD
177- 192 (30.22/10.10) DHSK.KHHEKK.RKHDG..D
193- 212 (27.51/ 8.58) EYINDVHKHKKsKHKSSKID
---------------------------------------------------------------------------
|