<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14350
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MEKLQSYKSRGFQYQLGDFQLRVGKVVPSHSENLRGIVMEVEYIPISPMEKARQIMEEFVDICKKPSQKRSVPGHFLHMEPNFAEYGLLDYYTPQHTAVQYATVVPQMIATQTRRVQAARN |
| Length | 121 |
| Position | Head |
| Organism | Manihot esculenta (Cassava) (Jatropha manihot) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Crotonoideae> Manihoteae>
Manihot.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.498 |
| Instability index | 44.95 |
| Isoelectric point | 9.07 |
| Molecular weight | 14034.01 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP14350
No repeats found
No repeats found
|