<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14344
| Description |
Uncharacterized protein |
| Sequence | MPDPTSATGPADLARIQEIEERVIRGVELASSVTELLSSIGNVDKDKVKQMCVDFLENMKTAQSLVQAALTKPAVERTFEANSYQAQARAYIAAEKVHTVQGYLSCMETCLVGREDNAVELEVHNGMDVDSVLVTGR |
| Length | 137 |
| Position | Head |
| Organism | Chlamydomonas eustigma |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Chlamydomonadales> Chlamydomonadaceae> Chlamydomonas.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.163 |
| Instability index | 29.69 |
| Isoelectric point | 4.71 |
| Molecular weight | 14914.74 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14344
No repeats found
No repeats found
|