<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14344
Description |
Uncharacterized protein |
Sequence | MPDPTSATGPADLARIQEIEERVIRGVELASSVTELLSSIGNVDKDKVKQMCVDFLENMKTAQSLVQAALTKPAVERTFEANSYQAQARAYIAAEKVHTVQGYLSCMETCLVGREDNAVELEVHNGMDVDSVLVTGR |
Length | 137 |
Position | Head |
Organism | Chlamydomonas eustigma |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Chlamydomonadales> Chlamydomonadaceae> Chlamydomonas.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.163 |
Instability index | 29.69 |
Isoelectric point | 4.71 |
Molecular weight | 14914.74 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14344
No repeats found
No repeats found
|