<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14333
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MSALVGYTSSSASSDHDDDMQGGSVEVDDQAPSQPPPPPPTEAEAAAEVAPAAPAPAPPGVTSEQPQQEDRPDGKEEQDEDEDQGDDDDDDDKDDDVTPEPDYSFASPPPPPLDANGDGEDGERDLPEKKPALDDDDKEERPTTLKAATRIHELDAIQQDIAKLLHLAGCTLASLDPEPNPNLDPTTEKHDPDTTIPEDKKERFDHFARSYFTTLNKADLFIVLVHLSQDIQLSLRTSIRHLALSKPSPQALLDPNYASLLPTAALEPGQSSIAAGGTAHRSRIDPLPLTKTIPKWKTGDAKAASAGGVKEDGSMKLSVAARELQAEAWRDLAQLGAGQHPTKGE |
| Length | 345 |
| Position | Head |
| Organism | Microbotryum intermedium |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.851 |
| Instability index | 50.62 |
| Isoelectric point | 4.32 |
| Molecular weight | 36877.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14333
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 220.34| 57| 69| 105| 173| 1
---------------------------------------------------------------------------
36- 99 (42.03/11.19) ...PPPPPTEAEAaaevapaapapappgvtseqpqqeDRPDGKEEQDEDEDQGDDDDDDDK........DDDVTP..............
105- 161 (101.97/55.77) FASPPPPPLDANG........................DGEDGERDLPEKKPALDDDDKEER........PTTLKAATRIHELDAIQQDI
175- 231 (76.34/26.81) LDPEPNPNLDPTT........................EKHDPDTTIPE........DKKERfdhfarsyFTTLNKADLFIVLVHLSQDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.49| 15| 43| 236| 250| 2
---------------------------------------------------------------------------
236- 250 (26.60/13.94) RTSIRHLALSKPSPQ
281- 295 (26.88/14.15) RSRIDPLPLTKTIPK
---------------------------------------------------------------------------
|