Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSALVGYTSSSASSDHDDDMQGGSVEVDDQAPSQPPPPPPTEAEAAAEVAPAAPAPAPPGVTSEQPQQEDRPDGKEEQDEDEDQGDDDDDDDKDDDVTPEPDYSFASPPPPPLDANGDGEDGERDLPEKKPALDDDDKEERPTTLKAATRIHELDAIQQDIAKLLHLAGCTLASLDPEPNPNLDPTTEKHDPDTTIPEDKKERFDHFARSYFTTLNKADLFIVLVHLSQDIQLSLRTSIRHLALSKPSPQALLDPNYASLLPTAALEPGQSSIAAGGTAHRSRIDPLPLTKTIPKWKTGDAKAASAGGVKEDGSMKLSVAARELQAEAWRDLAQLGAGQHPTKGE |
Length | 345 |
Position | Head |
Organism | Microbotryum intermedium |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Microbotryales> Microbotryaceae> Microbotryum. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.851 |
Instability index | 50.62 |
Isoelectric point | 4.32 |
Molecular weight | 36877.69 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP14333 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 220.34| 57| 69| 105| 173| 1 --------------------------------------------------------------------------- 36- 99 (42.03/11.19) ...PPPPPTEAEAaaevapaapapappgvtseqpqqeDRPDGKEEQDEDEDQGDDDDDDDK........DDDVTP.............. 105- 161 (101.97/55.77) FASPPPPPLDANG........................DGEDGERDLPEKKPALDDDDKEER........PTTLKAATRIHELDAIQQDI 175- 231 (76.34/26.81) LDPEPNPNLDPTT........................EKHDPDTTIPE........DKKERfdhfarsyFTTLNKADLFIVLVHLSQDI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.49| 15| 43| 236| 250| 2 --------------------------------------------------------------------------- 236- 250 (26.60/13.94) RTSIRHLALSKPSPQ 281- 295 (26.88/14.15) RSRIDPLPLTKTIPK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MSALVGYT 2) PTEAEAAAEVAPA | 1 40 | 8 52 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab