<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14313
Description |
Uncharacterized protein |
Sequence | MEQLQTALSTLKVLRSSVGQVFYSLANGIRADHGEENKENKYLLELQELLTTVGTNLRDVEQAVNSLNPPPGPFNLGNTAYLAQETTQDRQALYGTLVNVYKWTDKAHEYSNVAHQILSQNSLKRSSMSSNRAKRSRVQAGAHNSPPQQVDQVMASFDRLYSDMSITITRPYTSNAVIHVTLGHVLKAIIAFKGLMMERVVIKGYNEELDLWTESRYKVFQRVTDHAHAAMLHFYNPNFPELTLKSFFAWFHSFISLFNDPCKRCGLYLYGALPPTWRDPKSLGPYHFECKP |
Length | 292 |
Position | Tail |
Organism | Trichomalopsis sarcophagae |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Parasitoida> Chalcidoidea>
Pteromalidae> Pteromalinae> Trichomalopsis.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.388 |
Instability index | 36.84 |
Isoelectric point | 8.83 |
Molecular weight | 33234.38 |
Publications | PubMed=28648823
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14313
No repeats found
|