<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14310
Description |
Protein TolA |
Sequence | MKTGLASSVLLHLGVLGFAVISLSSPKPFEIDEAIAVTAISETELNQLVKGERRADKEEPPAPEKVEADELRTDAVNVGSNVADLDNAPSALPSERKVESSAAAAPPLPMARPEPKEKPVEVAKAEPEPEPEKEEKAEPKTEPEIDPVAELLKKAEQERQQQEEQRQAEEAKKKAEEEKRKAVEEEERKKRELAEAEAKRKAEAEAKKLAEAKALEDDIKALINKQDEKGGGARASTKTAGAGASRTNAPKLSASEMAALRDQLGGCWSIDAGIVEADSLLVSVTFSLDQNGKLEGQPRVTKSSGNPQFDRSAVRAIQKCNIQGLRVPEGKYETWREVIVNFDPRDMFF |
Length | 349 |
Position | Tail |
Organism | Notoacmeibacter marinus |
Kingdom | Bacteria |
Lineage | Bacteria> Proteobacteria> Alphaproteobacteria> Rhizobiales>
Notoacmeibacteraceae> Notoacmeibacter.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.755 |
Instability index | 52.79 |
Isoelectric point | 5.00 |
Molecular weight | 38016.25 |
Publications | PubMed=28771124
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | toxin transmembrane transporter activity GO:0019534 IEA:InterPro
|
GO - Biological Process | bacteriocin transport GO:0043213 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14310
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.44| 19| 19| 169| 187| 1
---------------------------------------------------------------------------
134- 161 (19.46/ 6.05) EEKAEPktepeidpvAELLKKAEQERQQ
182- 208 (21.98/ 7.81) AVEEEE.rkkrelaeAEAKRKAEAEAKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.99| 16| 19| 89| 107| 2
---------------------------------------------------------------------------
52- 68 (20.71/ 7.15) ERRADKE...EPPaPEKVEA
95- 114 (20.28/13.21) ERKVESSaaaAPPlPMARPE
---------------------------------------------------------------------------
|