<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14299
Description |
Uncharacterized protein |
Sequence | MAGALGGMFASQPPGPPPPGAPGGPGPAGLIPPPPGPRSANNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISIQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
Length | 178 |
Position | Head |
Organism | Colinus virginianus (Northern bobwhite) (Tetrao virginianus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Odontophoridae>
Colinus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.490 |
Instability index | 60.99 |
Isoelectric point | 5.42 |
Molecular weight | 19442.94 |
Publications | PubMed=24621616
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14299
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.72| 15| 17| 105| 119| 2
---------------------------------------------------------------------------
105- 119 (25.06/19.00) QKPEQVIKEDVSELR
123- 137 (24.66/18.60) QRKEALIQKHLSKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.14| 14| 18| 143| 158| 3
---------------------------------------------------------------------------
143- 158 (21.65/16.36) LEDISiqHKKPAEMPQ
164- 177 (25.49/13.13) LEQAS..ANIPAPMKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.80| 15| 22| 41| 62| 4
---------------------------------------------------------------------------
41- 55 (25.01/31.14) NNTLVDELEASFEAC
66- 80 (26.79/13.85) NGTDQEEIRTGVDQC
---------------------------------------------------------------------------
|