<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14298
| Description |
Uncharacterized protein |
| Sequence | MDYDFKVKLTGERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALGTKIEVEPMVSNKLVFKLNKMKKKMSCRSIVQEKLLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLVSSCMHNIK |
| Length | 355 |
| Position | Kinase |
| Organism | Colinus virginianus (Northern bobwhite) (Tetrao virginianus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Odontophoridae>
Colinus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.435 |
| Instability index | 43.60 |
| Isoelectric point | 9.32 |
| Molecular weight | 41341.81 |
| Publications | PubMed=24621616
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14298
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 35| 186| 200| 1
---------------------------------------------------------------------------
186- 200 (26.77/19.28) DLKPANILVMGEGPE
224- 238 (28.67/21.12) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|