<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14297
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVTMMPVTGGTINMMEYLLQGSVLDQSLESLLHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDKAAMPWHLRYLGQPEIGDKNRHALVRNCVDIATSDNLTDFLVEMGFRMDHEFVAKGHVFRKGIMKIVVYKIFRILMPGNTESIEPLSLSYLVELNVVAPAGQDVVSDDMRNFAEQLKPLVHLEKIDPKRLM |
Length | 208 |
Position | Head |
Organism | Colinus virginianus (Northern bobwhite) (Tetrao virginianus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Odontophoridae>
Colinus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.079 |
Instability index | 45.18 |
Isoelectric point | 5.97 |
Molecular weight | 23696.51 |
Publications | PubMed=24621616
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14297
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.33| 12| 25| 165| 176| 1
---------------------------------------------------------------------------
165- 176 (19.95/14.74) LSYLVELNVVAP
193- 204 (21.38/16.28) LKPLVHLEKIDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 131.17| 39| 63| 19| 58| 2
---------------------------------------------------------------------------
19- 58 (63.61/48.33) MEYLLQGSVLDQSLESLLHRLRGLCDNMEPETFLdHEMVF
85- 123 (67.56/46.41) LRYLGQPEIGDKNRHALVRNCVDIATSDNLTDFL.VEMGF
---------------------------------------------------------------------------
|