<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14283
Description |
Uncharacterized protein |
Sequence | MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEGKSLWAPHALFSSQISLLFLRFILKAASLHRLEEENHEAAARLEEVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQPLPDS |
Length | 135 |
Position | Middle |
Organism | Colinus virginianus (Northern bobwhite) (Tetrao virginianus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Odontophoridae>
Colinus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.252 |
Instability index | 52.10 |
Isoelectric point | 5.47 |
Molecular weight | 14795.54 |
Publications | PubMed=24621616
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14283
No repeats found
No repeats found
|