<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14278
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFSALFGGAEPPPATAAAALGFGPAKAAGSGAAPPPAAAVPPPGEDAARKAAAGPFYLLRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFTPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR |
| Length | 237 |
| Position | Head |
| Organism | Colinus virginianus (Northern bobwhite) (Tetrao virginianus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Odontophoridae>
Colinus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.882 |
| Instability index | 64.87 |
| Isoelectric point | 9.83 |
| Molecular weight | 25496.85 |
| Publications | PubMed=24621616
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14278
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.48| 21| 21| 183| 203| 1
---------------------------------------------------------------------------
161- 181 (35.47/18.95) IQPPKKKNKHKHKQSRTQDPV
183- 203 (35.75/19.15) PETPSDSDHKKKKKKKEEDPE
205- 221 (28.26/13.64) KRKKKE...KKKKKNRH.SPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.37| 21| 21| 10| 30| 2
---------------------------------------------------------------------------
10- 30 (38.94/17.98) GAEPPPATAAAALGFGPAKAA
33- 53 (40.43/18.92) GAAPPPAAAVPPPGEDAARKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.28| 29| 38| 60| 91| 3
---------------------------------------------------------------------------
60- 91 (48.94/34.72) LLRELPGSTELTGSTNlitHYNLEHAYNK..FCG
101- 131 (49.34/28.12) FLPDLPGMIDLPGSHD...NSSLRSLIEKppICG
---------------------------------------------------------------------------
|