<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14249
Description |
Uncharacterized protein |
Sequence | MGPAEELVRIAKKLDKMVARKSTEGALDLLKSLTGYTMTIQLLQTTRIGVAVNSMRKHCSDEEVVASAKILIKNWKRLLESSAPPKKEKDADGEKKEKEKRLDVPSPNEGVNPHAVKHPKSPAEKHREKHKERCGIQRDSADSRSSVSSSSSSPQKRPSGERRPSTGANPLPAPNSSRRSSSDSTGDRANSNKGKVETPRTPGSPPFSPSVCLLAPCYLTGDSVRDKCIEMLTAALRMDGEQDGVVRGTRPQRGRKWELKSTDMKYRNRVRSRISNLKDPKNPNLRRNVLCGAIAPALIARMTAEEMASDELKELRNAMTQEAIREHQMAKTGGTVTDLFQCGKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKVRDGLEELPCIHEFCSYIRGYHSYTYRYLSYIHGYHSCIRGYHSYTYRYLSYIHGYHSPITG |
Length | 440 |
Position | Unknown |
Organism | Callipepla squamata (Scaled quail) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Odontophoridae>
Callipepla.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.838 |
Instability index | 49.09 |
Isoelectric point | 9.54 |
Molecular weight | 49395.65 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14249
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 95.85| 20| 20| 396| 415| 1
---------------------------------------------------------------------------
396- 415 (47.93/28.87) IRGYHSYTYRYLSYIHGYHS
417- 436 (47.93/28.87) IRGYHSYTYRYLSYIHGYHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.86| 29| 29| 94| 122| 2
---------------------------------------------------------------------------
94- 122 (51.20/29.79) EK.KEKEK.RL....DVPSPNEGVNPHAVKHPKSP
124- 158 (33.66/17.12) EKhREKHKeRCgiqrDSADSRSSVSSSSSSPQKRP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.65| 12| 15| 255| 268| 4
---------------------------------------------------------------------------
255- 268 (19.08/18.07) RKWELKstDMKYRN
273- 284 (22.56/13.81) RISNLK..DPKNPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.77| 21| 27| 328| 348| 8
---------------------------------------------------------------------------
328- 348 (36.92/21.75) QMAKTGGTVTDLFQCGKCKKK
356- 376 (37.85/22.45) QTRSADEPMTTFVLCNECGNR
---------------------------------------------------------------------------
|