<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14245
| Description |
Uncharacterized protein |
| Sequence | MAGALGGMFANQPPGPPPPGAPGGPGPAGLIPPPPGPRSANNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISIQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
| Length | 178 |
| Position | Head |
| Organism | Callipepla squamata (Scaled quail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Odontophoridae>
Callipepla.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.505 |
| Instability index | 59.48 |
| Isoelectric point | 5.42 |
| Molecular weight | 19469.97 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14245
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.72| 15| 17| 105| 119| 2
---------------------------------------------------------------------------
105- 119 (25.06/18.77) QKPEQVIKEDVSELR
123- 137 (24.66/18.38) QRKEALIQKHLSKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.14| 14| 18| 143| 158| 3
---------------------------------------------------------------------------
143- 158 (21.65/18.37) LEDISiqHKKPAEMPQ
164- 177 (25.49/14.79) LEQAS..ANIPAPMKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.80| 15| 22| 41| 62| 4
---------------------------------------------------------------------------
41- 55 (25.01/27.41) NNTLVDELEASFEAC
66- 80 (26.79/12.13) NGTDQEEIRTGVDQC
---------------------------------------------------------------------------
|