Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDFPQLAVASLSTSNSKADLSPQNPNSFYPHSPTSPPLMSVGAQSYASNFANTHTSPSHTTSNGQPLSSPPSSTPMSAQTSLQPAVSVTNSFPTPASSVSGHPRNTTPADESENTDKAWGHGTNAVENADATNIDQSEHRRSNHDRHKLNMEGWPASADVDMMDVDSKMDSSLIRDSSLDALQQDIGTAFHLCKSVPTVTGPDPSLDIISLYGLGPIGRSVMRADPVTGEKINRLRKSYEGKLKGLGLSGRNKAVKNEGGQSGGLRHLMMWPEEEWHIQKVHGKEIRVAEAESALHKLQMRAMKLEPGPLPNSEYWEDILGHEKQPKHGVDSGKRAVSTPNAVRPVAQANGVATATTMPERMRATRGKKRHYDDNSFVGYGEGYVDDDDEAGLYSQGEDRSGKKKRKKVYFTSSAS |
Length | 417 |
Position | Head |
Organism | Talaromyces atroroseus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces> Talaromyces sect. Trachyspermi. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.795 |
Instability index | 50.99 |
Isoelectric point | 6.60 |
Molecular weight | 45143.44 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP14220 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 88.30| 30| 32| 67| 97| 1 --------------------------------------------------------------------------- 26- 71 (44.60/24.48) PNSFYPHSPTS.PPLMSVgaqsyasnfANTHTSPShttsngqPLSSP 72- 108 (43.70/28.11) PSSTPMSAQTSlQPAVSV.........TNSFPTPA.ssvsghPRNTT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 85.93| 26| 32| 120| 146| 3 --------------------------------------------------------------------------- 120- 146 (43.93/32.02) WGHGTNaVENAD.ATNIDQSEHRRSNHD 155- 181 (42.00/25.92) WPASAD.VDMMDvDSKMDSSLIRDSSLD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) YVDDDDEAGLYSQGEDRSGKKKRKKVYFTSSAS 2) YWEDIL | 385 316 | 417 321 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab