<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14215
| Description |
Uncharacterized protein |
| Sequence | MPRPAIPKPGFSVLRLHNSKNPHLIAHLSSAEKRNLLNSVAQDIEGCIWVVGHYIQSGHLDATHTFEFDQIINEIHRDERDEMEKKLRKMTVKTKIYKRREKALRREMKKRQERRRQRREERRRDEQQRMVTSSQQTSVDPTTADVECFETGCLHAGPSNQIDRDPRAGSGRGLSAADNTTTQVTVVSVDEFEESFSS |
| Length | 198 |
| Position | Tail |
| Organism | Talaromyces atroroseus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces>
Talaromyces sect. Trachyspermi.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.984 |
| Instability index | 64.03 |
| Isoelectric point | 9.24 |
| Molecular weight | 22865.43 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14215
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.50| 13| 14| 87| 100| 1
---------------------------------------------------------------------------
87- 100 (17.05/15.35) LRKmTVKTKIYKRR
104- 116 (22.45/14.20) LRR.EMKKRQERRR
---------------------------------------------------------------------------
|