Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAQPSLTQEDIKVLEQLRQRLSQLTNNIASQKSDLVRSNPLPPWVSLQTSASILAGNIESLTSLMSRHSELLNRMVVYPSTNYPGRTQEGILTQLLRKKMEPHVETWVQEGRATQAEVMEGRTNEKSEDELLVWAKDWVGNRVVKYAMEEAGDNYTIEEREQGIKNVKTGLKRNLEEDESDEDEDEDEEMKDMGVAVTTVRRTSFGQIEFGLGELQKDPNAKSKSIDEILRFGASGRR |
Length | 238 |
Position | Head |
Organism | Marssonina coronariae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Dermateaceae> Marssonina. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.773 |
Instability index | 57.18 |
Isoelectric point | 4.91 |
Molecular weight | 27010.92 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP14209 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 101.85| 26| 28| 85| 110| 1 --------------------------------------------------------------------------- 61- 79 (21.88/10.60) ........LTSLMSRHSELLNRMVVYP 85- 110 (43.93/27.85) GR.TQEGILTQLLRKKMEPHVETWVQE 111- 137 (36.04/21.68) GRaTQAEVMEGRTNEKSEDELLVWAKD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PNAKSKSIDEILRFGASGRR 2) VAVTTVRRTSFGQIEFGLGELQK | 219 195 | 238 217 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab