<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14201
| Description |
Uncharacterized protein |
| Sequence | MDNMVDSLNSAYQEFVLAAANVLEAKEVSSTQKISATDAALENFKQKWELFRVACDQAEEFVESVKQRIGSECLVDEATGTVVGKPGQGATTGLPPISAVRLEQMSKAVRCLVIELQSGAGVPGGGSQSHSSSAPFDTRFSEDSAQ |
| Length | 146 |
| Position | Tail |
| Organism | Punica granatum (Pomegranate) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.203 |
| Instability index | 53.58 |
| Isoelectric point | 4.60 |
| Molecular weight | 15472.07 |
| Publications | PubMed=28654223
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14201
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.19| 16| 35| 73| 89| 1
---------------------------------------------------------------------------
73- 89 (26.54/22.14) CLVDEATGTvVGKPGQG
111- 126 (30.65/20.56) CLVIELQSG.AGVPGGG
---------------------------------------------------------------------------
|