<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14189
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MAGALGGMFGSQGPGPPPGPPGPPGLIPPPAGPRNPNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
| Length | 174 |
| Position | Head |
| Organism | Lonchura striata domestica (Bengalese finch) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Lonchura.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.540 |
| Instability index | 56.64 |
| Isoelectric point | 5.42 |
| Molecular weight | 19145.59 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP14189
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.72| 15| 16| 101| 115| 1
---------------------------------------------------------------------------
101- 115 (25.06/19.08) QKPEQVIKEDVSELR
119- 133 (24.66/18.67) QRKEALIQKHLSKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.14| 14| 18| 139| 154| 2
---------------------------------------------------------------------------
139- 154 (21.65/17.15) LEDISvqHKKPAEMPQ
160- 173 (25.49/13.86) LEQAS..ANIPAPMKQ
---------------------------------------------------------------------------
|