<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14186
| Description |
Mediator of RNA polymerase II transcription subunit 22 (Fragment) |
| Sequence | MAQPRVLPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLKSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDSNDLPLCEAYWRQDFATLSPESLSMPLAAA |
| Length | 173 |
| Position | Head |
| Organism | Lonchura striata domestica (Bengalese finch) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Lonchura.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.538 |
| Instability index | 65.45 |
| Isoelectric point | 4.60 |
| Molecular weight | 19862.16 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14186
No repeats found
No repeats found
|