<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14175
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MWGRRSTNGGAGRPGAGHAGNMENFSALFGAAEPPPAAAAALGFGPAKAPGAGTAPPPAASAAAPPPGEDAARKAAGGPFYLLRELPGTTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDSSSLRSLIEKPPICGSSFTPLTGAMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSLR |
| Length | 257 |
| Position | Head |
| Organism | Lonchura striata domestica (Bengalese finch) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Lonchura.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.892 |
| Instability index | 63.30 |
| Isoelectric point | 9.98 |
| Molecular weight | 27397.93 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14175
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.04| 17| 20| 34| 51| 1
---------------------------------------------------------------------------
34- 51 (31.86/14.96) PPP...AAAAALGfGP....AKAPG
65- 88 (25.18/ 7.55) PPPgedAARKAAG.GPfyllRELPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.46| 16| 17| 205| 220| 2
---------------------------------------------------------------------------
186- 201 (26.45/12.16) PKKKNKHKHKQSRTQD
205- 220 (26.61/12.27) PETPSDSDHKKKKKKK
224- 239 (26.40/12.13) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.45| 13| 111| 128| 143| 3
---------------------------------------------------------------------------
128- 143 (21.39/18.19) PGmidLPGSHDSSSLR
245- 257 (24.06/11.95) PG...VGSSQASSSLR
---------------------------------------------------------------------------
|