<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14174
| Description |
Transcription elongation factor A protein 2 |
| Sequence | MGGEDEIVRIARRLDKMVAKKNAEGAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVISLAKSLIKSWKKLLDASEEKNEDKKKSLSLPTSSSRETGNSRDQSSNKRQEPPKTPTTPKITTFPPAPITCDAVRNKCREMLTAALQADDDYIAIGADCEHIAAQIEECIYQDVKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGAITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC |
| Length | 300 |
| Position | Unknown |
| Organism | Lonchura striata domestica (Bengalese finch) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Lonchura.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.724 |
| Instability index | 54.58 |
| Isoelectric point | 8.84 |
| Molecular weight | 33684.35 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | centrosome GO:0005813 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14174
No repeats found
No repeats found
|