<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14164
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVTCVSQVPVAEGKSVQQTVELLARRLEALGADKQGTFGVDCETYHTAAALGTQGQTGKLMYVMHNSEYPLSCFALFENGPCLVADTNFDTLMVKLKGFFQNAKANKIESRGTRYQYCDFLVKLGTVTMGPSARGISVEVEYCPCVIANDCWNLLMEFMQSFMGSHTPGVPPVFSSKHDSTYSPGDTMVQYMELFNKIRKQQQVPVAGISVSQVPVAEGKSVQQTVELLARRLEALGADKQGTFGVDCETYHTAAALGTQGQTGKLMYVMHNSEYPLSCFALFENGPCLVADTNFDTLMVKLKGFFQNAKANKIESRGTRYQYCDFLVKLGTVTMGPSARGISVEVEYCPCVIANDCWNLLMEFMQSFMGSHTPGVPPVFSSKHDSTYSPGDTMVQYMELFNKIRKQQQVPVAGIR |
Length | 417 |
Position | Head |
Organism | Lonchura striata domestica (Bengalese finch) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae>
Estrildinae> Lonchura.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.106 |
Instability index | 35.07 |
Isoelectric point | 6.26 |
Molecular weight | 45896.23 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14164
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 149.42| 19| 31| 119| 137| 1
---------------------------------------------------------------------------
119- 137 (38.02/24.91) C.DFLVKLGTVTMGPSARGI
152- 171 (36.69/23.77) CwNLLMEFMQSFMGSHTPGV
325- 343 (38.02/24.91) C.DFLVKLGTVTMGPSARGI
358- 377 (36.69/23.77) CwNLLMEFMQSFMGSHTPGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 680.87| 166| 204| 7| 210| 2
---------------------------------------------------------------------------
7- 210 (340.44/223.75) SQVPVAEGKSVQQTVELLARRLEALGADKQGTFGVDCETYHTAAALGTQGQTGKLMYVMHNSEYPLSCFALFENGPCLVADTNFDTLMVKLKGFFQNAKANKIESRGTRYQYcdflvklgtvtmgpsargiSVEVEYCPCVIANDcWnllmefmqsfmgshtpgvPPVFSSKHDSTYSPGDTMVQYMELFNKIRKQQQVPVAGI
213- 416 (340.44/223.75) SQVPVAEGKSVQQTVELLARRLEALGADKQGTFGVDCETYHTAAALGTQGQTGKLMYVMHNSEYPLSCFALFENGPCLVADTNFDTLMVKLKGFFQNAKANKIESRGTRYQYcdflvklgtvtmgpsargiSVEVEYCPCVIANDcWnllmefmqsfmgshtpgvPPVFSSKHDSTYSPGDTMVQYMELFNKIRKQQQVPVAGI
---------------------------------------------------------------------------
|