Description | Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MKVAAQNLVQNSNIDNGQKSADGALQRFDKSLEEFYALCDQLELCLRLAHECLSQSFDSAKHAPALVPAAPKGEGGAGGGESLPYTQYLPLIKAQIAGAKDIHNALLEGTNKITGRLPPPGGP |
Length | 123 |
Position | Tail |
Organism | Lonchura striata domestica (Bengalese finch) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Passeroidea> Estrildidae> Estrildinae> Lonchura. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.305 |
Instability index | 54.14 |
Isoelectric point | 5.86 |
Molecular weight | 12938.51 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP14163 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) ALVPAAPK 2) GAGGGESLPYTQYLPLIKAQIA 3) KDIHNALLEG 4) KITGRL | 65 76 100 112 | 72 97 109 117 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab