<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14158
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMSDQFRKVEPYSPKSSPRGARSPVVSRQDSSGTLKTTISLGKNPSIVHSGPFYLMKEPPGECELTGATNLMAYYGLEHSYSKFNGKKLKESLSSFLPNLPGIVDGPGQEDNSTLASVLAKRPIGGKELIPLTSSQLAGFRLHPGPLPEQYRYISATPPKRHKSKHKKHKHKDGAPPGQDTPLQDSSNPDTYEKKHKKQKRHDDDKERKKRKKEKKRKKQKHSPEHGGLTPNQHPVP |
| Length | 237 |
| Position | Head |
| Organism | Danaus plexippus plexippus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.202 |
| Instability index | 56.05 |
| Isoelectric point | 9.94 |
| Molecular weight | 26450.76 |
| Publications | PubMed=22118469
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14158
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.59| 26| 32| 144| 173| 1
---------------------------------------------------------------------------
144- 173 (46.35/28.30) PG.PLPEQyryiSATPPKRHKSKHKKHKHKD
177- 203 (45.24/19.58) PGqDTPLQ....DSSNPDTYEKKHKKQKRHD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 57.02| 12| 38| 86| 97| 2
---------------------------------------------------------------------------
86- 97 (19.05/11.78) GKKLKESLSSFL
108- 119 (18.29/11.05) GQEDNSTLASVL
126- 137 (19.67/12.39) GKELIPLTSSQL
---------------------------------------------------------------------------
|