<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14152
| Description |
Mediator of RNA polymerase 2 transcription subunit 13 like protein |
| Sequence | MTHQNHQTNGASLEDCHTNFFALTELYGIKWRKLVWGETSGVGAEGEEGAAPLADPVISSYARCLAGDILCVWRRVPAPQPLDIDIGLAAPPPLSLRASKELWIFWYGEEPDLNGLVAPELITSREYITSTSIETSYDQHVMDIKYYII |
| Length | 149 |
| Position | Middle |
| Organism | Danaus plexippus plexippus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.122 |
| Instability index | 39.38 |
| Isoelectric point | 4.66 |
| Molecular weight | 16594.58 |
| Publications | PubMed=22118469
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14152
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.25| 23| 27| 73| 99| 1
---------------------------------------------------------------------------
73- 97 (35.76/34.24) WRRVPAPQPlDIDiGLAAPPPLSLR
103- 125 (44.49/25.33) WIFWYGEEP.DLN.GLVAPELITSR
---------------------------------------------------------------------------
|