<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14150
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MDNTDHSEQNNFSPLTVQEVDVDFLPIVYEIIRSVERDFHDNSAKVRESQDCSLKVLELQRKFDVARSQIKRLPGIEYNKQDQLKQFEILSTQLRLKRELLQRYRNMCSFETSFK |
| Length | 115 |
| Position | Middle |
| Organism | Danaus plexippus plexippus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.755 |
| Instability index | 50.37 |
| Isoelectric point | 6.12 |
| Molecular weight | 13756.40 |
| Publications | PubMed=22118469
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14150
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.79| 23| 37| 2| 24| 1
---------------------------------------------------------------------------
2- 24 (39.49/26.22) DNTDHSEQNNFSPLTVQEVDVDF
41- 63 (37.30/24.43) DNSAKVRESQDCSLKVLELQRKF
---------------------------------------------------------------------------
|