Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MDNTDHSEQNNFSPLTVQEVDVDFLPIVYEIIRSVERDFHDNSAKVRESQDCSLKVLELQRKFDVARSQIKRLPGIEYNKQDQLKQFEILSTQLRLKRELLQRYRNMCSFETSFK |
Length | 115 |
Position | Middle |
Organism | Danaus plexippus plexippus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea> Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.755 |
Instability index | 50.37 |
Isoelectric point | 6.12 |
Molecular weight | 13756.40 |
Publications | PubMed=22118469 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP14150 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.79| 23| 37| 2| 24| 1 --------------------------------------------------------------------------- 2- 24 (39.49/26.22) DNTDHSEQNNFSPLTVQEVDVDF 41- 63 (37.30/24.43) DNSAKVRESQDCSLKVLELQRKF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FSPLTVQEVDVDFLPIVYEIIRSVER 2) KVLELQRKFDVARSQIKRLPGIEYNK | 12 55 | 37 80 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab