<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14149
| Description |
Surfeit 5 |
| Sequence | MHRNLPQNKEALLKSYTTRLKEDVKSMLENFEEIIKLAKGENESQLNRMTQIEQDTFEMQVRAANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQQECDQKLMSLRDDIAADLYDLEDEYFTSIYK |
| Length | 138 |
| Position | Head |
| Organism | Danaus plexippus plexippus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.652 |
| Instability index | 47.20 |
| Isoelectric point | 5.00 |
| Molecular weight | 16188.24 |
| Publications | PubMed=22118469
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14149
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.41| 16| 39| 73| 88| 1
---------------------------------------------------------------------------
73- 88 (27.87/16.27) LMKLVSDIKQYLI.LND
114- 130 (23.54/12.97) LMSLRDDIAADLYdLED
---------------------------------------------------------------------------
|