<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14147
Description |
Intersex protein |
Sequence | MHVPMNPVGANPNVGMQGMPVSVSIMPVASPQQMQPVMAPQPPQQDKMDNISKVKTLMGSLRESLPMTLKSAAQILHLNYNIDSNTQKGIDNPVPRFDKNLEEFFSLCDQMELHLRTAITCIQQAQSAAHYLPLTVIPSRLDSGPTTQETTLSYPQYLNTVRLQISYAKDIHDTLVAAAQNISPTE |
Length | 186 |
Position | Tail |
Organism | Danaus plexippus plexippus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.284 |
Instability index | 66.15 |
Isoelectric point | 5.91 |
Molecular weight | 20525.36 |
Publications | PubMed=22118469
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14147
No repeats found
|