<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14143

Description Mediator of RNA polymerase 2 transcription subunit 25
SequenceMVVNAPDSPIQAEVIFVIEATSVNSAFINELKTNYIIPTLEYFHGGALEEGVGSGSVYGVVAYQAADCHPGSPVSTFGPFTSPETVIDTVDNIQFIGGHAESRACVTEALTVALSCLEELGRTDIPMHVVLLCCSPPYSAYNGGLVPAGAPATVEQAGRLIAERGVQLSIAAAKRLPALLALYEHAGGELHTAQQRNYAKDPRHLVLLRGYSLKERPPSPAPPPAPDIQTDVYGYTYSALLFLSCPAARASGPQYRPGGPARGWLAPPPRQQYANSALLTQLAQPSCPPPPIQANIQRMQLLQPGPSGPLQRTYIWSGVLEWMEKGKTPGDQQKVTKLLPCQVSANSKDIEPELKVDTWPSKLLMQLMPKQLISNIGGQYLKDSKSVLFHLQQNEALDALTKVMVNGFAGCVHFSPMSSPPQCDIKVLILLYTSDKKAFLGFIPNNQATFVDRLRKVIQQQKMNKQIPVPVSAAAMTGNMPAATMAGNYCDYLQSLSRFVGLTFHDSCNNAGMIMGGGMAGQVGQVGQVNQVGQVSQVGQVGGKGPRGVPLDGLEAARQQNLEKIQHLQQTLEAAHQQEAQFKSQMDIMSHLHAAQQQEQEQQRKHQLQHQLQQQLRGAQRGMRPIMPTNPGLRHLLQQQPQYRAAGTGRPPGQQFEDVANYNDFL
Length666
PositionUnknown
OrganismDanaus plexippus plexippus
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea> Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
Aromaticity0.06
Grand average of hydropathy-0.271
Instability index50.55
Isoelectric point7.92
Molecular weight72314.84
Publications
PubMed=22118469

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14143
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.85|      19|      19|     568|     586|       1
---------------------------------------------------------------------------
  568-  586 (34.45/23.60)	LQQTLEAAHQ..QEAQFKSQM
  588-  608 (29.41/18.84)	IMSHLHAAQQqeQEQQRKHQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     105.29|      19|      21|     267|     285|       2
---------------------------------------------------------------------------
  222-  257 (19.44/ 6.19)	PPPAPDiqtdvygYTYSALLflscpaarasgPQY.RP
  267-  285 (35.66/16.97)	PPPRQQ.......YANSALL...........TQLAQP
  289-  304 (27.09/11.28)	PPPIQ.........ANIQRM............QLLQP
  309-  326 (23.10/ 8.63)	.PLQRT.......YIWSGVL...........EWMEKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.68|      17|      65|      68|      86|       3
---------------------------------------------------------------------------
   68-   86 (31.22/25.62)	CHPgsPVSTFG....PFTSPETV
  134-  154 (29.47/16.79)	CSP..PYSAYNgglvPAGAPATV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.88|      16|      23|     609|     625|       5
---------------------------------------------------------------------------
  609-  625 (27.78/21.65)	QHQLQQ..QLRGAQRGmRP
  634-  651 (27.10/15.38)	RHLLQQqpQYRAAGTG.RP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14143 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LEKIQHLQQTLEAAHQQEAQFKSQMDIMSHLHAAQQQEQEQQRKHQLQHQLQQQLRGAQRGMRPIMPTNPGLRHLLQQQPQYRAAGTGRPPGQQFEDVANY
562
662










Molecular Recognition Features






MoRF SequenceStartStop




NANANA