<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14137
| Description |
Mediator of RNA polymerase 2 transcription subunit 16 |
| Sequence | MFRALRPSEECMSVCLSWTAREWEGPPRCCVSAPHPRQLPLYLEYGVEPDMLRYVPEPPPHAQSDTSASQDMDSIRYMYLGGRGRAARWRQCGRCGARALPEPRAAPHALQRAYDGRYLAHCRCGGNWTLVSNV |
| Length | 134 |
| Position | Tail |
| Organism | Danaus plexippus plexippus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.587 |
| Instability index | 60.50 |
| Isoelectric point | 8.70 |
| Molecular weight | 15179.18 |
| Publications | PubMed=22118469
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14137
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.28| 13| 27| 83| 96| 2
---------------------------------------------------------------------------
83- 96 (24.17/14.11) RGRAARW.RQCgRCG
112- 125 (24.11/ 9.82) RAYDGRYlAHC.RCG
---------------------------------------------------------------------------
|