<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14131
Description |
Mediator of RNA polymerase II transcription subunit 15 (Fragment) |
Sequence | VNMGMAASPSSSLNTPVGGGVASPGGEEAAYREKVRQLSKYIEPLRRMVLRMVSEGENVEKLTKMKNLLDILSNPNKRMPLETLIKCEVVLEKLDFKRSEGVGLGLPSAGKEQIFNPLLEVVNNCLQSPLANHTLKRTFGSTLDALNGPEIKNLPPPPPKIAKVEEPTMEIPDVLQGEIARLDSRFKVSLETMQLSGGEGAISLIAQLDDVRLPCVPAVHVTVPRDYPAASPARLRPKTTKRNNEDCFLARVEKAMDARCARLPKSCSVGQLLDAWEMSVRQACAPNPQAYNAVPALGLLVHTCSERHVVCVWCVVGSAGGTWRVAGRPSAAGPVSRPRPARVTVTAACGIRIGNTSQLGHKTRLPRYW |
Length | 369 |
Position | Tail |
Organism | Danaus plexippus plexippus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea>
Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.206 |
Instability index | 53.84 |
Isoelectric point | 9.33 |
Molecular weight | 40000.03 |
Publications | PubMed=22118469
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14131
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 144.54| 50| 83| 17| 68| 1
---------------------------------------------------------------------------
17- 68 (73.93/55.21) VGGGVASpGGEEAAYREKVRQLSKYIE.PLRRMVLRMvSEGENVEKLT..KMKNL
102- 154 (70.61/43.80) VGLGLPS.AGKEQIFNPLLEVVNNCLQsPLANHTLKR.TFGSTLDALNgpEIKNL
---------------------------------------------------------------------------
|