Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MSSPLENLETQLEMFIENVRQIRIIVSDFQPQGQSVLNQKIQSLVTGLQEVDKLKAQVHDIHVPTEVFDYIDQGRNPQLYTKDCIDKALAKNEEVKGKIDSYKRFKSHLLSELSKTFPNEIAKYKAIRGGE |
Length | 131 |
Position | Middle |
Organism | Danaus plexippus plexippus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Lepidoptera> Glossata> Ditrysia> Papilionoidea> Nymphalidae> Danainae> Danaini> Danaina> Danaus> Danaus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.556 |
Instability index | 42.48 |
Isoelectric point | 6.31 |
Molecular weight | 15032.98 |
Publications | PubMed=22118469 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP14121 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) EVKGKIDSYKRFKS 2) KYKAIR 3) TKDCI | 94 123 81 | 107 128 85 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab