<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14118
Description |
Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MAASADHRNPPSQQQQQQLTDSDPVHRVKFLMPRLKESLANLIKVAGQSLRQNALTDDGLRPADSQQLKFEKSLEEFYSLCDQIESNLRLALEIHQQNTDSQKFIPFTVNVPKENNQWPETPSAVPYTQFISMVRQQISCAKEIHDLLMECSKKISD |
Length | 157 |
Position | Tail |
Organism | Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Mollusca> Bivalvia>
Autobranchia> Pteriomorphia> Pectinida> Pectinoidea> Pectinidae>
Mizuhopecten.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.667 |
Instability index | 64.76 |
Isoelectric point | 5.80 |
Molecular weight | 17951.08 |
Publications | PubMed=28812685
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14118
No repeats found
|