<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14110
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASGKEGDDAAQSPPTQVELLKFGSVDPMGLIKCWVYPDIVIKPGNLYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPGSKELAHRQQFFFWKNFRNNRLKHIVPRPLPEPIAAPPASVPPPATLVTAASVAPPAAPALSPMHYAMPPGSSMPKTDIRNIPVDRRKRKWLSWRVAYLSSEGNIPVIGMAFLSPSWYTFERGSDAT |
Length | 258 |
Position | Middle |
Organism | Macleaya cordata |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae>
Macleaya.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.317 |
Instability index | 56.24 |
Isoelectric point | 9.01 |
Molecular weight | 29506.70 |
Publications | PubMed=28552780
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14110
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.51| 19| 22| 109| 130| 1
---------------------------------------------------------------------------
62- 79 (27.90/11.77) ....LEFVQCLANPTYIHYLAQ
91- 103 (19.92/ 7.45) Y...LKYLQYWQRPEY......
109- 130 (27.69/21.00) YphcLYFLELLQNANFRNAMAH
---------------------------------------------------------------------------
|