<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14109

Description Fibrillarin
SequenceMRPPRGRGGGGFRGRSDGPGGRGRGGRSFGDAGRGRGRGDRGGRGPGRGRGVGRGRGGMKGGSKVMVEPHRHQGVFIAKGKEDALVTKNMVPGEAVYGEKRVSVQNEDGTKIEYRVWNPFRSKLAAAILGGVDNVWIVPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNIIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASYFLKNGGHFVISIKANCIDSTVPAEAVFAQEVKKLQQDQFKPSEQVTLEPFERDHACVVGGYRVPKKQKAAA
Length303
PositionUnknown
OrganismMacleaya cordata
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae> Macleaya.
Aromaticity0.07
Grand average of hydropathy-0.415
Instability index30.21
Isoelectric point10.31
Molecular weight32481.74
Publications
PubMed=28552780

Function

Annotated function
GO - Cellular Component
GO - Biological Function
methyltransferase activity	GO:0008168	IEA:UniProtKB-KW
RNA binding	GO:0003723	IEA:UniProtKB-KW
GO - Biological Process
methylation	GO:0032259	IEA:UniProtKB-KW
rRNA processing	GO:0006364	IEA:UniProtKB-KW

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP14109
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.00|      14|      16|       5|      20|       1
---------------------------------------------------------------------------
   14-   30 (21.86/12.52)	GRSDGPGgR.GRGGRsfG
   33-   48 (23.15/ 7.58)	GRGRGRGdRgGRGPG..R
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.27|      14|      17|     193|     206|       2
---------------------------------------------------------------------------
  193-  206 (25.29/14.79)	IIEDARHPAKYRML
  213-  226 (23.99/13.74)	IFSDVAQPDQARIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     190.27|      58|     159|      71|     131|       4
---------------------------------------------------------------------------
   71-  131 (90.22/66.42)	RHQGVFIAKGKEDALvtKNMVPGEAVYGEKRVSVQNEDGTKIEYRVWNPFRSKlAAAILGG
  235-  292 (100.05/63.56)	KNGGHFVISIKANCI..DSTVPAEAVFAQEVKKLQQDQFKPSEQVTLEPFERD.HACVVGG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP14109 with Med36 domain of Kingdom Viridiplantae

Unable to open file!