<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14106
| Description |
Uncharacterized protein |
| Sequence | MDPEGKKFGKGPRELTGAVDLINHYKLSTHHEFFCKRSLPLSIADSHYLHNVVGDTEIRKGEGMELAQLLQNSSYLRDKNAQIQPFDLETLGEAFQLRETGPIDLPSAEKGIPTIAGKSKSESKDKDKERKHKKHKDRDKEKNKEHKKHKHRRKDRSKDKDMEKKKDRSGHHDSSAEHSKKHHDKKRKREGSEDLSEIQKHKNSKHRSSKIDEMGAIKVAG |
| Length | 221 |
| Position | Head |
| Organism | Macleaya cordata |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae>
Macleaya.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.486 |
| Instability index | 43.60 |
| Isoelectric point | 9.61 |
| Molecular weight | 25430.34 |
| Publications | PubMed=28552780
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14106
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.90| 15| 15| 124| 138| 1
---------------------------------------------------------------------------
124- 138 (29.87/10.53) KDKDKERKHKKHKDR
193- 207 (22.03/ 6.07) EDLSEIQKHKNSKHR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.11| 19| 21| 149| 168| 2
---------------------------------------------------------------------------
149- 168 (29.68/15.57) HKHRRKDRSKdKDMEKKKDR
171- 189 (33.44/13.90) HHDSSAEHSK.KHHDKKRKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 28.75| 9| 20| 76| 88| 4
---------------------------------------------------------------------------
76- 88 (11.90/22.14) LRDKNaqiqPFDL
97- 105 (16.84/13.13) LRETG....PIDL
---------------------------------------------------------------------------
|