<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14086
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAATATYPPPPPYYRLYKDFIENPKSTPEPPPPIEGTYILYGATYTTDDVLPSLEDQGVRQLYPKGPDVDFKKELRSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKEAIEDIKRRREEAQRLLKESLGTLDGH |
| Length | 169 |
| Position | Middle |
| Organism | Macleaya cordata |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae>
Macleaya.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.643 |
| Instability index | 70.10 |
| Isoelectric point | 6.60 |
| Molecular weight | 19629.20 |
| Publications | PubMed=28552780
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP14086
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.96| 15| 19| 27| 41| 1
---------------------------------------------------------------------------
6- 17 (27.97/12.57) TYPPPPP.....YYRLY
27- 41 (32.19/15.38) TPEPPPPIE..GTYILY
47- 63 (20.80/ 7.79) TDDVLPSLEdqGVRQLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.87| 27| 45| 75| 113| 2
---------------------------------------------------------------------------
75- 107 (35.24/47.98) LRSLN.RELQLHILELAdvlVERPSQyarRVEDI
121- 148 (42.63/22.78) LRPHQaRATLIHILELQ...IQRRKE...AIEDI
---------------------------------------------------------------------------
|