Description | Mediator complex |
Sequence | MDIISQLQEQVNTIASLAFNTFGTLQRDAPPVRLSPNYPEPPANPTEIALNISEQPKLMSAALVKAAKQFDVLVAALPVSEGDEEAQLKWIAELQAENEEVGQELQRQLEAAEMELKQVQELFNQAADNCLNLKKPD |
Length | 137 |
Position | Middle |
Organism | Macleaya cordata |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae> Macleaya. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.353 |
Instability index | 61.26 |
Isoelectric point | 4.31 |
Molecular weight | 15139.93 |
Publications | PubMed=28552780 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP14084 No repeats found |
MoRF Sequence | Start | Stop |
1) AALVKAA 2) EEAQLKWIAELQAENEEVGQEL 3) LSPNYP 4) TEIALNISEQ | 61 84 34 46 | 67 105 39 55 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab