| Description | Mediator complex |
| Sequence | MDIISQLQEQVNTIASLAFNTFGTLQRDAPPVRLSPNYPEPPANPTEIALNISEQPKLMSAALVKAAKQFDVLVAALPVSEGDEEAQLKWIAELQAENEEVGQELQRQLEAAEMELKQVQELFNQAADNCLNLKKPD |
| Length | 137 |
| Position | Middle |
| Organism | Macleaya cordata |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae> Macleaya. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.353 |
| Instability index | 61.26 |
| Isoelectric point | 4.31 |
| Molecular weight | 15139.93 |
| Publications | PubMed=28552780 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP14084 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AALVKAA 2) EEAQLKWIAELQAENEEVGQEL 3) LSPNYP 4) TEIALNISEQ | 61 84 34 46 | 67 105 39 55 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab