<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14077
| Description |
Zinc finger protein |
| Sequence | MDANNDWKTQADQASREKLVNKLFEHFQRSVSISCPEQLDEIKEAAARYEERVYNRATSWMGYLRKISLKLMNVEADAQRLQSNPTDATTSNGNPSDGGSTQTPVLPVTGKQKADELGKQKADELEQPVSKKVTQTPVLPVTGKQKADELEQPVSKKVRLFGVEICDFVEKSGQQDGKLVCSLCLDCLKETDEIRELPKCFHKFHKGCFDAWVDRGKFICPYCGSFF |
| Length | 227 |
| Position | Tail |
| Organism | Macleaya cordata |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae>
Macleaya.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.665 |
| Instability index | 33.95 |
| Isoelectric point | 6.35 |
| Molecular weight | 25570.71 |
| Publications | PubMed=28552780
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14077
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.68| 16| 23| 118| 133| 1
---------------------------------------------------------------------------
118- 133 (32.34/20.89) GKQKADELEQPVSKKV
143- 158 (32.34/20.89) GKQKADELEQPVSKKV
---------------------------------------------------------------------------
|