<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14074
Description |
Cyclin |
Sequence | MAANFWSSSHLKLLMDQEEVDVVHSPDKERGLTLEEFKYIKMHMANYIGKLAQFVKVRQRVVATAVTYMRRVYTRKSMTEYDPCLVAPTCLYLASKAEESTVQARLLVFYIKKQLTDEKYRFEIKDILEMEMKILEALDYYLVVYHPYRPLSQLLQDAGMTDMTHLSWGLVNDTYKMDLILIYPPYMIALACIYIASVLKDKDTTAWFEELRADMNVVKNISMEMLDFYDNHKILPEDRVNAIINKLSLKQ |
Length | 251 |
Position | Kinase |
Organism | Macleaya cordata |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Ranunculales> Papaveraceae> Papaveroideae>
Macleaya.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.121 |
Instability index | 45.62 |
Isoelectric point | 6.10 |
Molecular weight | 29471.17 |
Publications | PubMed=28552780
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14074
No repeats found
|