<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14046
| Description |
Uncharacterized protein |
| Sequence | MRFLQYVHSFSPHPSLTLFPQHLICHHPGYPGPTLRMLDLLQQDQFRKDAISPALIDDLVRTGFEASTAGLVGGGR |
| Length | 76 |
| Position | Middle |
| Organism | Hortaea werneckii EXF-2000 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Hortaea.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.117 |
| Instability index | 49.82 |
| Isoelectric point | 6.96 |
| Molecular weight | 8470.64 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14046
No repeats found
No repeats found
|