<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14045

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMAQQGAAQPKAPFPQPPPFYKHFTKANAAELKRQRKELASPQPHDEERFNSAHQPSDLNILSLPPELRYLIPPTPPDTTTPNNPPKAFSQALNLAPAPPTLADLSIDPLHPTHPSVLSNPQPHLLALSRSLLTTFLHLVGAQSQNAEAWEESTRHLERIVGSMHELINAYRPHQARESLILEMEGRVEGMRGEVERIREGRRRVEGLFQELSGEGGGDEGAVMGDWEGTVKGMEKVGGLGRRGGRGRGMLGMRSGR
Length256
PositionMiddle
OrganismHortaea werneckii EXF-2000
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Hortaea.
Aromaticity0.05
Grand average of hydropathy-0.685
Instability index55.01
Isoelectric point7.19
Molecular weight28159.54
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. 

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364060
ECO:0000256	ARBA:ARBA00003669

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP14045
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.48|      24|      25|     176|     200|       1
---------------------------------------------------------------------------
  176-  200 (38.72/24.85)	R.ESLILEMEGRVEGMR..GEVERiREG
  203-  222 (21.38/ 8.30)	RvEGLFQELSGEGGGDE..GAV......
  225-  244 (23.38/ 9.95)	.......DWEGTVKGMEkvGGLGR.RGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      64.12|      12|      24|      14|      26|       2
---------------------------------------------------------------------------
   14-   26 (21.86/15.54)	PQPPPfYKHFTKA
   41-   52 (21.31/ 9.86)	PQPHD.EERFNSA
   81-   91 (20.95/ 9.58)	PNNPP..KAFSQA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.89|      19|      21|     126|     146|       3
---------------------------------------------------------------------------
  126-  146 (27.56/25.70)	ALSRSllTTFL.HLVGAQSQ..NA
  148-  169 (26.33/17.43)	AWEES..TRHLeRIVGSMHEliNA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      71.35|      15|      55|      53|      67|       4
---------------------------------------------------------------------------
   53-   67 (28.75/15.51)	HQPSD..............LNILSLP.PEL
   73-  101 (18.89/ 7.63)	PTPPDtttpnnppkafsqaLNLAPAP.PTL
  110-  124 (23.72/11.49)	H.PTH..............PSVLSNPqPHL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP14045 with Med7 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LPPELRYLIPPTPPDTTTPNNPPKAFSQALNL
2) MAQQGAAQPKAPFPQPPPFYKHFTKANAAELKRQRKELASPQPHDEERFNSAHQPSDL
63
1
94
58










Molecular Recognition Features






MoRF SequenceStartStop




1) QPPPFYKHFTKANAAELKRQRKELA
15
39